Recombinant Full Length Human GRPR Protein
Cat.No. : | GRPR-209HF |
Product Overview : | Recombinant full length Human GRPR (amino acids 1-384) with N terminal proprietary tag; Predicted MWt 68.31 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 384 amino acids |
Description : | Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene. |
Form : | Liquid |
Molecular Mass : | 68.310kDa inclusive of tags |
AA Sequence : | MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGIL YVIPAVYGVIILIGLIGNITLIKIFCTVKSMRNVPNLFIS SLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLK AAFIWIISMLLAIPEAVFSDLHPFHEESTNQTFISCAPYP HSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPN HVIYLYRSYHYSEVDTSMLHFVTSICARLLAFTNSCVNPF ALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS LKSTNPSVATFSLINGNICHERYV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GRPR gastrin-releasing peptide receptor [ Homo sapiens ] |
Official Symbol | GRPR |
Synonyms | GRPR; gastrin-releasing peptide receptor |
Gene ID | 2925 |
mRNA Refseq | NM_005314 |
Protein Refseq | NP_005305 |
MIM | 305670 |
UniProt ID | P30550 |
◆ Recombinant Proteins | ||
GRPR-3349H | Recombinant Human GRPR Protein (Met1-Lys114), N-GST tagged | +Inquiry |
GRPR-30H | Recombinant Human GRPR protein, hFc-tagged | +Inquiry |
GRPR-5977C | Recombinant Chicken GRPR | +Inquiry |
GRPR-1802R | Recombinant Rhesus Macaque GRPR Protein, His (Fc)-Avi-tagged | +Inquiry |
Grpr-7836M | Recombinant Mouse Grpr protein, His & GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRPR Products
Required fields are marked with *
My Review for All GRPR Products
Required fields are marked with *
0
Inquiry Basket