Recombinant Full Length Human GSC Protein, GST-tagged
Cat.No. : | GSC-5617HF |
Product Overview : | Human GSC full-length ORF ( NP_776248.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 257 amino acids |
Description : | This gene encodes a member of the bicoid subfamily of the paired (PRD) homeobox family of proteins. The encoded protein acts as a transcription factor and may be autoregulatory. A similar protein in mice plays a role in craniofacial and rib cage development during embryogenesis. [provided by RefSeq |
Molecular Mass : | 54.5 kDa |
AA Sequence : | MPASMFSIDNILAARPRCKDSVLPVAHSAAAPVVFPALHGDSLYGASGGASSDYGAFYPRPVAPGGAGLPAAVSGSRLGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GSC goosecoid homeobox [ Homo sapiens ] |
Official Symbol | GSC |
Synonyms | GSC; goosecoid homeobox; homeobox protein goosecoid; |
Gene ID | 145258 |
mRNA Refseq | NM_173849 |
Protein Refseq | NP_776248 |
MIM | 138890 |
UniProt ID | P56915 |
◆ Recombinant Proteins | ||
GSC-3950M | Recombinant Mouse GSC Protein, His (Fc)-Avi-tagged | +Inquiry |
GSC-6883C | Recombinant Chicken GSC | +Inquiry |
GSC-8647Z | Recombinant Zebrafish GSC | +Inquiry |
GSC-5617HF | Recombinant Full Length Human GSC Protein, GST-tagged | +Inquiry |
GSC-13555H | Recombinant Human GSC, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSC-5728HCL | Recombinant Human GSC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSC Products
Required fields are marked with *
My Review for All GSC Products
Required fields are marked with *