Recombinant Full Length Human GSDME Protein, C-Flag-tagged
Cat.No. : | GSDME-894HFL |
Product Overview : | Recombinant Full Length Human GSDME Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Hearing impairment is a heterogeneous condition with over 40 loci described. The protein encoded by this gene is expressed in fetal cochlea, however, its function is not known. Nonsyndromic hearing impairment is associated with a mutation in this gene. Three transcript variants encoding two different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLSLVTKKKRFWCWQRPKYQFLSLTLGDVLIEDQFPSP VVVESDFVKYEGKFANHVSGTLETALGKVKLNLGGSSRVESQSSFGTLRKQEVDLQQLIRDSAERTINLR NPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGNVTKDSNVVLE IPAATTIAYGVIELYVKLDGLFEFCLLRGKQGGFENKKRIDSVYLDHLVFREFAFIDMPDAAHGISSQDG PLSVLKQATLLLERNFHPFAELPEPQQTALSDIFQAVVFDDELLMVLEPVCDDLVSGLSPTVAVLGELKP RQQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLL RALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASADISLERLKSSVKAVILKDSKVFPLLLCITLNGLCA LGREHSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | GSDME gasdermin E [ Homo sapiens (human) ] |
Official Symbol | GSDME |
Synonyms | DFNA5; ICERE-1 |
Gene ID | 1687 |
mRNA Refseq | NM_004403.3 |
Protein Refseq | NP_004394.1 |
MIM | 608798 |
UniProt ID | O60443 |
◆ Recombinant Proteins | ||
GSDME-894HFL | Recombinant Full Length Human GSDME Protein, C-Flag-tagged | +Inquiry |
GSDME-1025H | Recombinant Human GSDME Protein, His (Fc)-Avi-tagged | +Inquiry |
GSDME-279H | Recombinant Human GSDME Protein, MYC/DDK-tagged | +Inquiry |
Gsdme-3315M | Recombinant Mouse Gsdme Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSDME Products
Required fields are marked with *
My Review for All GSDME Products
Required fields are marked with *