Recombinant Full Length Human GSTA3 Protein
Cat.No. : | GSTA3-212HF |
Product Overview : | Recombinant full length Human GSTA3 with N terminal proprietary tag. Predicted MW 50.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 222 amino acids |
Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. |
Form : | Liquid |
Molecular Mass : | 50.530kDa inclusive of tags |
AA Sequence : | MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAED LGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYN LYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISL VELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQP GSPRKPPADAKALEEARKIFRF |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GSTA3 glutathione S-transferase alpha 3 [ Homo sapiens ] |
Official Symbol | GSTA3 |
Synonyms | GSTA3; glutathione S-transferase alpha 3; glutathione S transferase A3; glutathione S-transferase A3 |
Gene ID | 2940 |
mRNA Refseq | NM_000847 |
Protein Refseq | NP_000838 |
MIM | 605449 |
UniProt ID | Q16772 |
◆ Recombinant Proteins | ||
GSTA3-317C | Recombinant Cynomolgus Monkey GSTA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA3-13571H | Recombinant Human GSTA3, His-tagged | +Inquiry |
Gsta3-755M | Recombinant Mouse Gsta3 protein, His-tagged | +Inquiry |
GSTA3-754C | Recombinant Chicken GSTA3 protein, His & T7-tagged | +Inquiry |
GSTA3-242H | Recombinant Human GSTA3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTA3-758HCL | Recombinant Human GSTA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTA3 Products
Required fields are marked with *
My Review for All GSTA3 Products
Required fields are marked with *