Recombinant Full Length Human GSTO1 Protein, GST-tagged

• Cat.No.: GSTO1-3365HF
• Product Overview: Human GSTO1 full-length ORF ( NP_004823.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 241 amino acids
• Description: This gene encodes a member of the theta class glutathione S-transferase-like (GSTTL) protein family. In mouse, the encoded protein acts as a small stress response protein, likely involved in cellular redox homeostasis. [provided by RefSeq
• Molecular Mass: 54 kDa
• AA Sequence: MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GSTO1 glutathione S-transferase omega 1 [ Homo sapiens ]
• Official Symbol: GSTO1
• Synonyms: GSTO1; glutathione S-transferase omega 1; glutathione S-transferase omega-1; GSTTLp28; P28; GSTO-1; MMA(V) reductase; glutathione-S-transferase like; monomethylarsonic acid reductase; S-(Phenacyl)glutathione reductase; glutathione S-transferase omega 1-1; glutathione-dependent dehydroascorbate reductase; SPG-R; GSTO 1-1; DKFZp686H13163
• Gene ID: 9446
• mRNA Refseq: NM_001191002
• Protein Refseq: NP_001177931
• MIM: 605482
• UniProt ID: P78417