Recombinant Full Length Human GTF2A1 Protein, GST-tagged

Cat.No. : GTF2A1-3373HF
Product Overview : Human GTF2A1 full-length ORF ( NP_056943.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 376 amino acids
Description : Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and several general initiation factors (summarized by DeJong and Roeder, 1993 [PubMed 8224848]). One of these factors is TFIIA, which when purified from HeLa extracts consists of 35-, 19-, and 12-kD subunits.[supplied by OMIM, Jul 2010]
Molecular Mass : 67.9 kDa
AA Sequence : MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTF2A1 general transcription factor IIA, 1, 19/37kDa [ Homo sapiens ]
Official Symbol GTF2A1
Synonyms GTF2A1; general transcription factor IIA, 1, 19/37kDa; glucose regulated protein, 58kD pseudogene; transcription initiation factor IIA subunit 1; TFIIA; TFIIAL; TFIIA-42; TFIIA alpha, p55, isoform 1; general transcription factor IIA subunit 1; transcription initiation factor TFIIA 42 kDa subunit; TF2A1; MGC129969; MGC129970;
Gene ID 2957
mRNA Refseq NM_015859
Protein Refseq NP_056943
MIM 600520
UniProt ID P52655

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF2A1 Products

Required fields are marked with *

My Review for All GTF2A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon