Recombinant Full Length Human GTF2I Protein, GST-tagged

Cat.No. : GTF2I-3399HF
Product Overview : Human GTF2I full-length ORF ( AAH04472.1, 36 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 274 amino acids
Description : This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7, 13 and 21. [provided by RefSeq
Molecular Mass : 52.03 kDa
AA Sequence : ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTF2I general transcription factor IIi [ Homo sapiens ]
Official Symbol GTF2I
Synonyms GTF2I; general transcription factor IIi; general transcription factor II, i , WBSCR6; general transcription factor II-I; BAP 135; BTKAP1; DIWS; IB291; SPIN; TFII I; BTK-associated protein 135; BTK-associated protein, 135kD; SRF-Phox1-interacting protein; Williams-Beuren syndrome chromosome region 6; Bruton tyrosine kinase-associated protein 135; williams-Beuren syndrome chromosomal region 6 protein; WBS; BAP135; TFII-I; WBSCR6; GTFII-I; FLJ38776; FLJ56355;
Gene ID 2969
mRNA Refseq NM_001163636
Protein Refseq NP_001157108
MIM 601679
UniProt ID P78347

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF2I Products

Required fields are marked with *

My Review for All GTF2I Products

Required fields are marked with *

0
cart-icon
0
compare icon