Recombinant Full Length Human GTSE1-AS1 Protein, GST-tagged

Cat.No. : GTSE1-AS1-1910HF
Product Overview : Human CN5H6.4 full-length ORF ( CAK54413.1 , 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 101 amino acids
Description : GTSE1-DT (GTSE1 Divergent Transcript) is an RNA Gene, and is affiliated with the lncRNA class.
Molecular Mass : 37.51 kDa
AA Sequence : MELESTIFRDEDKLFIWGRLWGELCSKQPPGAQGRGLPGWLGHFWVPCPWFCIIHTNHSMLLCSFTRRLGAQKGQGSPHSPVSPASPSSAQGTRQGLRVLG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GTSE1-AS1 GTSE1 antisense RNA 1 (head to head) [ Homo sapiens (human) ]
Official Symbol GTSE1-AS1
Synonyms CN5H6.4; GTSE1-AS1; LL22NC03-5H6.6
Gene ID 150384

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTSE1-AS1 Products

Required fields are marked with *

My Review for All GTSE1-AS1 Products

Required fields are marked with *

0
cart-icon
0
compare icon