Recombinant Human GTSE1-AS1 Protein, GST-tagged

• Cat.No.: GTSE1-AS1-1549H
• Product Overview: Human CN5H6.4 full-length ORF ( CAK54413.1 , 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GTSE1-AS1 (GTSE1 Antisense RNA 1 (Head To Head)) is an RNA Gene, and is affiliated with the lncRNA class.
• Molecular Mass: 37.51 kDa
• AA Sequence: MELESTIFRDEDKLFIWGRLWGELCSKQPPGAQGRGLPGWLGHFWVPCPWFCIIHTNHSMLLCSFTRRLGAQKGQGSPHSPVSPASPSSAQGTRQGLRVLG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GTSE1-AS1 GTSE1 antisense RNA 1 (head to head) [ Homo sapiens (human) ]
• Official Symbol: GTSE1-AS1
• Synonyms: GTSE1-AS1; GTSE1 antisense RNA 1 (head to head); GTSE1 Antisense RNA 1 (Head To Head); LL22NC03-5H6.6; CN5H6.4
• Gene ID: 150384