Recombinant Full Length Human GYG2 Protein, GST-tagged
| Cat.No. : | GYG2-3361HF |
| Product Overview : | Human GYG2 full-length ORF ( AAH23152.1, 1 a.a. - 470 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 470 amino acids |
| Description : | This gene encodes a member of the the glycogenin family. Glycogenin is a self-glucosylating protein involved in the initiation reactions of glycogen biosynthesis. A gene on chromosome 3 encodes the muscle glycogenin and this X-linked gene encodes the glycogenin mainly present in liver; both are involved in blood glucose homeostasis. This gene has a short version on chromosome Y, which is 3' truncated and can not make a functional protein. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, May 2010] |
| Molecular Mass : | 78.4 kDa |
| AA Sequence : | MSVTDQAFVTLATNDIYCQGALVLGQSLRRHRLTRKLVVLITPQVSSLLRVILSKVFDEVIEVNLIDSADYIHLAFLKRPELGLTLTKLHCWTLTHYSKCVFLDADTLVLSNVDELFDRGEFSAAPDPGWPDCFNSGVFVFQPSLHTHKLLLQHAMEHGSFDGADQGLLNSFFRNWSTTDIHKHLPFIYNLSSNTMYTYSPAFKQFGSSAKVVHFLGSMKPWNYKYNPQSGSVLEQGSVSSSQHQAAFLHLWWTVYQNNVLPLYKSVQAGEARASPGHTLCRSDVGGPCADSASGVGEPCENSTPSAGVPCANSPLGSNQPAQGLPEPTQIVDETLSLPEGRRSEDMIACPETETPAVITCDPLSQPSPQPADFTETETILQPANKVESVSSEETFEPSQELPAEALRDPSLQDALEVDLAVSVSQISIEEKVKELSPEEERRKWEEGRIDYMGKDAFARIQEKLDRFLQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GYG2 glycogenin 2 [ Homo sapiens ] |
| Official Symbol | GYG2 |
| Synonyms | GYG2; glycogenin 2; glycogenin-2; GN 2; GN2; GN-2; |
| Gene ID | 8908 |
| mRNA Refseq | NM_001079855 |
| Protein Refseq | NP_001073324 |
| MIM | 300198 |
| UniProt ID | O15488 |
| ◆ Recombinant Proteins | ||
| GYG2-4504H | Recombinant Human GYG2 Protein, GST-tagged | +Inquiry |
| GYG2-6037H | Recombinant Human GYG2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GYG2-2546H | Recombinant Human GYG2 Protein, MYC/DDK-tagged | +Inquiry |
| GYG2-3361HF | Recombinant Full Length Human GYG2 Protein, GST-tagged | +Inquiry |
| GYG2-7330Z | Recombinant Zebrafish GYG2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GYG2-768HCL | Recombinant Human GYG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GYG2 Products
Required fields are marked with *
My Review for All GYG2 Products
Required fields are marked with *
