Recombinant Full Length Human GYPA Protein, GST-tagged
| Cat.No. : | GYPA-3375HF |
| Product Overview : | Human GYPA full-length ORF ( AAH13328.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 150 amino acids |
| Description : | Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq |
| Molecular Mass : | 42.7 kDa |
| AA Sequence : | MYGKIIFVLLLSAIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GYPA glycophorin A (MNS blood group) [ Homo sapiens ] |
| Official Symbol | GYPA |
| Synonyms | GYPA; glycophorin A (MNS blood group); glycophorin A (includes MN blood group) , glycophorin A (MN blood group) , MNS; glycophorin-A; CD235a; GPA; MN; glycophorin MiI; glycophorin MiV; glycophorin SAT; glycophorin Erik; glycophorin A, GPA; MN sialoglycoprotein; glycophorin Sta type C; sialoglycoprotein alpha; Mi.V glycoprotein (24 AA); glycophorin A (MN blood group); recombinant glycophorin A-B Miltenberger-DR; erythroid-lineage-specific membrane sialoglycoprotein; MNS; GPSAT; PAS-2; GPErik; HGpMiV; HGpMiXI; HGpSta(C); |
| Gene ID | 2993 |
| mRNA Refseq | NM_002099 |
| Protein Refseq | NP_002090 |
| MIM | 617922 |
| UniProt ID | P02724 |
| ◆ Recombinant Proteins | ||
| RFL23215SF | Recombinant Full Length Pig Glycophorin-A(Gypa) Protein, His-Tagged | +Inquiry |
| GYPA-056H | Recombinant Human GYPA Protein, His-tagged | +Inquiry |
| Gypa-1824M | Recombinant Mouse Gypa protein, His-tagged | +Inquiry |
| RFL5212CF | Recombinant Full Length Dog Glycophorin-A(Gypa) Protein, His-Tagged | +Inquiry |
| GYPA-1345H | Recombinant Human GYPA Protein (Ser20-Gln150), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GYPA-749HCL | Recombinant Human GYPA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GYPA Products
Required fields are marked with *
My Review for All GYPA Products
Required fields are marked with *
