Recombinant Full Length Human GYPC Protein
| Cat.No. : | GYPC-3378HF |
| Product Overview : | Human GYPC full-length ORF (NP_002092.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 201 amino acids |
| Description : | Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. [provided by RefSeq |
| Form : | Liquid |
| Molecular Mass : | 13.8 kDa |
| AA Sequence : | MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GYPC glycophorin C (Gerbich blood group) [ Homo sapiens ] |
| Official Symbol | GYPC |
| Synonyms | GYPC; glycophorin C (Gerbich blood group); glycophorin-C; CD236; CD236R; Ge; GPC; GYPD; glycophorin-D; glycoconnectin; glycoprotein beta; sialoglycoprotein D; GE; GPD; PAS-2; MGC117309; MGC126191; MGC126192; |
| Gene ID | 2995 |
| mRNA Refseq | NM_001256584 |
| Protein Refseq | NP_001243513 |
| MIM | 110750 |
| UniProt ID | P04921 |
| ◆ Recombinant Proteins | ||
| GYPC-4229H | Recombinant Human GYPC Protein (Met1-Met57), C-His tagged | +Inquiry |
| Gypc-3342M | Recombinant Mouse Gypc Protein, Myc/DDK-tagged | +Inquiry |
| GYPC-2421R | Recombinant Rat GYPC Protein, His (Fc)-Avi-tagged | +Inquiry |
| GYPC-3378HF | Recombinant Full Length Human GYPC Protein | +Inquiry |
| GYPC-13632H | Recombinant Human GYPC, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GYPC-769HCL | Recombinant Human GYPC cell lysate | +Inquiry |
| GYPC-350HKCL | Human GYPC Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GYPC Products
Required fields are marked with *
My Review for All GYPC Products
Required fields are marked with *
