Recombinant Full Length Human GYPC Protein

• Cat.No.: GYPC-3378HF
• Product Overview: Human GYPC full-length ORF (NP_002092.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 201 amino acids
• Description: Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 13.8 kDa
• AA Sequence: MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: GYPC glycophorin C (Gerbich blood group) [ Homo sapiens ]
• Official Symbol: GYPC
• Synonyms: GYPC; glycophorin C (Gerbich blood group); glycophorin-C; CD236; CD236R; Ge; GPC; GYPD; glycophorin-D; glycoconnectin; glycoprotein beta; sialoglycoprotein D; GE; GPD; PAS-2; MGC117309; MGC126191; MGC126192
• Gene ID: 2995
• mRNA Refseq: NM_001256584
• Protein Refseq: NP_001243513
• MIM: 110750
• UniProt ID: P04921