Recombinant Full Length Human GYPC Protein
Cat.No. : | GYPC-3378HF |
Product Overview : | Human GYPC full-length ORF (NP_002092.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 201 amino acids |
Description : | Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duch antigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin C protein has very little homology with glycophorins A and B. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 13.8 kDa |
AA Sequence : | MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | GYPC glycophorin C (Gerbich blood group) [ Homo sapiens ] |
Official Symbol | GYPC |
Synonyms | GYPC; glycophorin C (Gerbich blood group); glycophorin-C; CD236; CD236R; Ge; GPC; GYPD; glycophorin-D; glycoconnectin; glycoprotein beta; sialoglycoprotein D; GE; GPD; PAS-2; MGC117309; MGC126191; MGC126192; |
Gene ID | 2995 |
mRNA Refseq | NM_001256584 |
Protein Refseq | NP_001243513 |
MIM | 110750 |
UniProt ID | P04921 |
◆ Recombinant Proteins | ||
GYPC-2538H | Recombinant Human GYPC Protein, MYC/DDK-tagged | +Inquiry |
GYPC-704H | Recombinant Human GYPC Protein, His-tagged | +Inquiry |
GYPC-2767R | Recombinant Rat GYPC Protein | +Inquiry |
RFL26130HF | Recombinant Full Length Human Glycophorin-C(Gypc) Protein, His-Tagged | +Inquiry |
GYPC-1833H | Recombinant Human GYPC protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GYPC-769HCL | Recombinant Human GYPC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GYPC Products
Required fields are marked with *
My Review for All GYPC Products
Required fields are marked with *
0
Inquiry Basket