Recombinant Full Length Human GYS2 Protein, C-Flag-tagged
Cat.No. : | GYS2-660HFL |
Product Overview : | Recombinant Full Length Human GYS2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene, liver glycogen synthase, catalyzes the rate-limiting step in the synthesis of glycogen - the transfer of a glucose molecule from UDP-glucose to a terminal branch of the glycogen molecule. Mutations in this gene cause glycogen storage disease type 0 (GSD-0) - a rare type of early childhood fasting hypoglycemia with decreased liver glycogen content. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 80.8 kDa |
AA Sequence : | MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWGENYFLIGPYF EHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDIGYSAWNLDRWKGDLWEACSV GIPYHDREANDMLIFGSLTAWFLKEVTDHADGKYVVAQFHEWQAGIGLILSRARKLPIATIFTTHATLLG RYLCAANIDFYNHLDKFNIDKEAGERQIYHRYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPN GLNVKKFSAVHEFQNLHAMYKARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLN FLLRMHKSDITVVVFFIMPAKTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDLNDIL DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPEFLSSTSPLLP MDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVADPTAYGIYIVDRRFRSP DDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYLGRYYQHARHLTLSRAFPDKFHVELTSPPT TEGFKYPRPSSVPPSPSGSQASSPQSSDVEDEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGE YKNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Insulin signaling pathway, Starch and sucrose metabolism |
Full Length : | Full L. |
Gene Name | GYS2 glycogen synthase 2 [ Homo sapiens (human) ] |
Official Symbol | GYS2 |
Synonyms | glycogen synthase 2 (liver) |
Gene ID | 2998 |
mRNA Refseq | NM_021957.4 |
Protein Refseq | NP_068776.2 |
MIM | 138571 |
UniProt ID | P54840 |
◆ Recombinant Proteins | ||
Gys2-3343M | Recombinant Mouse Gys2 Protein, Myc/DDK-tagged | +Inquiry |
GYS2-660HFL | Recombinant Full Length Human GYS2 Protein, C-Flag-tagged | +Inquiry |
GYS2-2672Z | Recombinant Zebrafish GYS2 | +Inquiry |
GYS2-7408M | Recombinant Mouse GYS2 Protein | +Inquiry |
GYS2-2769R | Recombinant Rat GYS2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GYS2-5669HCL | Recombinant Human GYS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GYS2 Products
Required fields are marked with *
My Review for All GYS2 Products
Required fields are marked with *
0
Inquiry Basket