Recombinant Full Length Human GZMA Protein, C-Flag-tagged
Cat.No. : | GZMA-1713HFL |
Product Overview : | Recombinant Full Length Human GZMA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 28.8 kDa |
AA Sequence : | MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHC NLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGD DVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNG DSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease, Secreted Protein |
Protein Pathways : | Neuroactive ligand-receptor interaction |
Full Length : | Full L. |
Gene Name | GZMA granzyme A [ Homo sapiens (human) ] |
Official Symbol | GZMA |
Synonyms | HFSP; CTLA3 |
Gene ID | 3001 |
mRNA Refseq | NM_006144.4 |
Protein Refseq | NP_006135.2 |
MIM | 140050 |
UniProt ID | P12544 |
◆ Recombinant Proteins | ||
GZMA-4516H | Recombinant Human GZMA Protein | +Inquiry |
GZMA-2225H | Recombinant Human GZMA Protein, His-tagged | +Inquiry |
GZMA-26406TH | Recombinant Human GZMA | +Inquiry |
Gzma-3009M | Recombinant Mouse Gzma protein, His-B2M-tagged | +Inquiry |
GZMA-6027C | Recombinant Chicken GZMA | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMA-5668HCL | Recombinant Human GZMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GZMA Products
Required fields are marked with *
My Review for All GZMA Products
Required fields are marked with *
0
Inquiry Basket