Recombinant Full Length Human GZMK Protein, GST-tagged
| Cat.No. : | GZMK-3391HF |
| Product Overview : | Human GZMK full-length ORF ( NP_002095.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 264 amino acids |
| Description : | This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. [provided by RefSeq |
| Molecular Mass : | 55.3 kDa |
| AA Sequence : | MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GZMK granzyme K (granzyme 3; tryptase II) [ Homo sapiens ] |
| Official Symbol | GZMK |
| Synonyms | GZMK; granzyme K (granzyme 3; tryptase II); granzyme K (serine protease, granzyme 3; tryptase II); granzyme K; PRSS; TRYP2; NK-Tryp-2; granzyme 3; granzyme-3; tryptase II; fragmentin-3; NK-tryptase-2; granzyme K (serine protease, granzyme 3; tryptase II); |
| Gene ID | 3003 |
| mRNA Refseq | NM_002104 |
| Protein Refseq | NP_002095 |
| MIM | 600784 |
| UniProt ID | P49863 |
| ◆ Recombinant Proteins | ||
| GZMK-3067H | ACTIVE Recombinant Human GZMK protein(Ile27~Asn264) | +Inquiry |
| GZMK-3391HF | Recombinant Full Length Human GZMK Protein, GST-tagged | +Inquiry |
| GZMK-220HF | Recombinant Full Length Human GZMK Protein | +Inquiry |
| GZMK-2023R | Recombinant Rhesus monkey GZMK Protein, His-tagged | +Inquiry |
| Gzmk-4525M | Recombinant Mouse Gzmk Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GZMK-5667HCL | Recombinant Human GZMK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GZMK Products
Required fields are marked with *
My Review for All GZMK Products
Required fields are marked with *
