Recombinant Full Length Human H1FOO Protein, GST-tagged

Cat.No. : H1FOO-3396HF
Product Overview : Human H1FOO full-length ORF ( AAH47943.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 207 amino acids
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein encoded is a replication-independent histone that is a member of the histone H1 family. This gene contains introns, unlike most histone genes. The related mouse gene is expressed only in oocytes. [provided by RefSeq, Oct 2015]
Molecular Mass : 47.4 kDa
AA Sequence : MAPATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQSGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name H1FOO H1 histone family member O oocyte specific [ Homo sapiens (human) ]
Official Symbol H1FOO
Synonyms H1 Histone Family Member O, Oocyte Specific; Oocyte-Specific Linker Histone H1; Oocyte-Specific Histone H1; H1oo; OsH1; H1 Histone Family, Member O, Oocyte-Specific; Histone H1oo; H1.8; H1FOO; H1 histone family member O oocyte specific; histone H1oo; oocyte-specific histone H1; oocyte-specific linker histone H1
Gene ID 132243
mRNA Refseq NM_001308262
Protein Refseq NP_001295191
UniProt ID Q8IZA3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H1FOO Products

Required fields are marked with *

My Review for All H1FOO Products

Required fields are marked with *

0
cart-icon
0
compare icon