Recombinant Full Length Human H1FX Protein, GST-tagged
Cat.No. : | H1FX-3397HF |
Product Overview : | Human H1FX full-length ORF ( NP_006017.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 213 amino acids |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H1 family. [provided by RefSeq |
Molecular Mass : | 48.9 kDa |
AA Sequence : | MSVELEEALPVTTAEGMAKKVTKAGGSAALSPSKKRKNSKKKNQPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSIKALVQNDTLLQVKGTGANGSFKLNRKKLEGGGERRGAPAAATAPAPTAHKAKKAAPGAAGSRRADKKPARGQKPEQRSHKKGAGAKKDKGGKAKKTAAAGGKKVKKAAKPSVPKVPKGRK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | H1FX H1 histone family, member X [ Homo sapiens ] |
Official Symbol | H1FX |
Synonyms | H1FX; H1 histone family, member X; histone H1x; H1X; MGC8350; MGC15959; |
Gene ID | 8971 |
mRNA Refseq | NM_006026 |
Protein Refseq | NP_006017 |
MIM | 602785 |
UniProt ID | Q92522 |
◆ Recombinant Proteins | ||
H1FX-2024R | Recombinant Rhesus monkey H1FX Protein, His-tagged | +Inquiry |
H1FX-9908Z | Recombinant Zebrafish H1FX | +Inquiry |
H1FX-4531H | Recombinant Human H1FX Protein, GST-tagged | +Inquiry |
H1FX-1845R | Recombinant Rhesus Macaque H1FX Protein, His (Fc)-Avi-tagged | +Inquiry |
H1FX-3397HF | Recombinant Full Length Human H1FX Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H1FX-2119HCL | Recombinant Human H1FX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H1FX Products
Required fields are marked with *
My Review for All H1FX Products
Required fields are marked with *
0
Inquiry Basket