Recombinant Full Length Human H3F3A Protein, GST-tagged
| Cat.No. : | H3F3A-3410HF |
| Product Overview : | Human H3F3A full-length ORF ( AAH29405, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 136 amino acids |
| Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is polyadenylated, unlike most histone genes. The protein encoded is a replication-independent member of the histone H3 family. [provided by RefSeq |
| Molecular Mass : | 40.7 kDa |
| AA Sequence : | MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTGLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | H3F3A H3 histone, family 3A [ Homo sapiens ] |
| Official Symbol | H3F3A |
| Synonyms | H3F3A; H3 histone, family 3A; H3F3; histone H3.3; H3.3A; H3F3B; MGC87782; MGC87783; |
| Gene ID | 3020 |
| mRNA Refseq | NM_002107 |
| Protein Refseq | NP_002098 |
| MIM | 601128 |
| UniProt ID | P84243 |
| ◆ Recombinant Proteins | ||
| H3F3A-116H | Recombinant Human H3F3A Protein, HIS-tagged | +Inquiry |
| H3F3A-12240Z | Recombinant Zebrafish H3F3A | +Inquiry |
| H3F3A-3013H | Recombinant Human H3F3A protein, His-SUMO-tagged | +Inquiry |
| H3F3A-568H | Recombinant Human H3 histone, family 3A, His-tagged | +Inquiry |
| H3F3A-3410HF | Recombinant Full Length Human H3F3A Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| H3F3A-5654HCL | Recombinant Human H3F3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H3F3A Products
Required fields are marked with *
My Review for All H3F3A Products
Required fields are marked with *
