Recombinant Human H3F3A protein, His-SUMO-tagged
| Cat.No. : | H3F3A-3013H |
| Product Overview : | Recombinant Human H3F3A protein(P84243)(2-136aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-136aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.2 kDa |
| AA Sequence : | ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | H3F3A H3 histone, family 3A [ Homo sapiens ] |
| Official Symbol | H3F3A |
| Synonyms | H3F3A; H3 histone, family 3A; H3F3; histone H3.3; H3.3A; H3F3B; MGC87782; MGC87783; |
| Gene ID | 3020 |
| mRNA Refseq | NM_002107 |
| Protein Refseq | NP_002098 |
| MIM | 601128 |
| UniProt ID | P84243 |
| ◆ Recombinant Proteins | ||
| H3F3A-4542H | Recombinant Human H3F3A Protein, GST-tagged | +Inquiry |
| H3F3A-3410HF | Recombinant Full Length Human H3F3A Protein, GST-tagged | +Inquiry |
| H3F3A-116H | Recombinant Human H3F3A Protein, HIS-tagged | +Inquiry |
| H3F3A-102H | Recombinant Human H3F3A Protein | +Inquiry |
| H3F3A-568H | Recombinant Human H3 histone, family 3A, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| H3F3A-5654HCL | Recombinant Human H3F3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All H3F3A Products
Required fields are marked with *
My Review for All H3F3A Products
Required fields are marked with *
