Recombinant Human H3F3A protein, His-SUMO-tagged
Cat.No. : | H3F3A-3013H |
Product Overview : | Recombinant Human H3F3A protein(P84243)(2-136aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-136aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.2 kDa |
AA Sequence : | ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | H3F3A H3 histone, family 3A [ Homo sapiens ] |
Official Symbol | H3F3A |
Synonyms | H3F3A; H3 histone, family 3A; H3F3; histone H3.3; H3.3A; H3F3B; MGC87782; MGC87783; |
Gene ID | 3020 |
mRNA Refseq | NM_002107 |
Protein Refseq | NP_002098 |
MIM | 601128 |
UniProt ID | P84243 |
◆ Recombinant Proteins | ||
H3F3A-568H | Recombinant Human H3 histone, family 3A, His-tagged | +Inquiry |
H3F3A-102H | Recombinant Human H3F3A Protein | +Inquiry |
H3F3A-62H | Recombinant Human H3F3A protein, T7/His-tagged | +Inquiry |
H3F3A-12240Z | Recombinant Zebrafish H3F3A | +Inquiry |
H3F3A-3013H | Recombinant Human H3F3A protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H3F3A-5654HCL | Recombinant Human H3F3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H3F3A Products
Required fields are marked with *
My Review for All H3F3A Products
Required fields are marked with *
0
Inquiry Basket