Recombinant Full Length Human HAO2 Protein, C-Flag-tagged
Cat.No. : | HAO2-906HFL |
Product Overview : | Recombinant Full Length Human HAO2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is one of three related genes that have 2-hydroxyacid oxidase activity. The encoded protein localizes to the peroxisome has the highest activity toward the substrate 2-hydroxypalmitate. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.7 kDa |
AA Sequence : | MSLVCLTDFQAHAREQLSKSTRDFIEGGADDSITRDDNIAAFKRIRLRPRYLRDVSEVDTRTTIQGEEIS APICIAPTGFHCLVWPDGEMSTARAAQAAGICYITSTFASCSLEDIVIAAPEGLRWFQLYVHPDLQLNKQ LIQRVESLGFKALVITLDTPVCGNRRHDIRNQLRRNLTLTDLQSPKKGNAIPYFQMTPISTSLCWNDLSW FQSITRLPIILKGILTKEDAELAVKHNVQGIIVSNHGGRQLDEVLASIDALTEVVAAVKGKIEVYLDGGV RTGNDVLKALALGAKCIFLGRPILWGLACKGEHGVKEVLNILTNEFHTSMALTGCRSVAEINRNLVQFSR LTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Glyoxylate and dicarboxylate metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | HAO2 hydroxyacid oxidase 2 [ Homo sapiens (human) ] |
Official Symbol | HAO2 |
Synonyms | GIG16; HAOX2 |
Gene ID | 51179 |
mRNA Refseq | NM_001005783.3 |
Protein Refseq | NP_001005783.2 |
MIM | 605176 |
UniProt ID | Q9NYQ3 |
◆ Recombinant Proteins | ||
HAO2-2442R | Recombinant Rat HAO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAO2-1515H | Recombinant Human HAO2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HAO2-3352HF | Recombinant Full Length Human HAO2 Protein, GST-tagged | +Inquiry |
HAO2-906HFL | Recombinant Full Length Human HAO2 Protein, C-Flag-tagged | +Inquiry |
HAO2-13H | Recombinant Human HAO2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAO2-5637HCL | Recombinant Human HAO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAO2 Products
Required fields are marked with *
My Review for All HAO2 Products
Required fields are marked with *
0
Inquiry Basket