Recombinant Full Length Human HAPLN1 Protein, GST-tagged
| Cat.No. : | HAPLN1-3355HF |
| Product Overview : | Human HAPLN1 full-length ORF ( AAH57808, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 354 amino acids |
| Description : | HAPLN1 (Hyaluronan And Proteoglycan Link Protein 1) is a Protein Coding gene. Diseases associated with HAPLN1 include Cerebral Creatine Deficiency Syndrome 3 and Cerebral Creatine Deficiency Syndrome 2. Among its related pathways are Phospholipase-C Pathway and ERK Signaling. GO annotations related to this gene include extracellular matrix structural constituent and hyaluronic acid binding. An important paralog of this gene is HAPLN3. |
| Molecular Mass : | 64.68 kDa |
| AA Sequence : | MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDVAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HAPLN1 hyaluronan and proteoglycan link protein 1 [ Homo sapiens ] |
| Official Symbol | HAPLN1 |
| Synonyms | HAPLN1; hyaluronan and proteoglycan link protein 1; cartilage linking protein 1 , CRTL1; Cartilage link protein; cartilage-link protein; proteoglycan link protein; cartilage linking protein 1; cartilage-linking protein 1; CRTL1; |
| Gene ID | 1404 |
| mRNA Refseq | NM_001884 |
| Protein Refseq | NP_001875 |
| MIM | 115435 |
| UniProt ID | P10915 |
| ◆ Recombinant Proteins | ||
| HAPLN1-7031C | Recombinant Chicken HAPLN1 | +Inquiry |
| HAPLN1-7544H | Recombinant Human HAPLN1 protein, His-SUMO-tagged | +Inquiry |
| Hapln1-5023M | Recombinant Mouse Hapln1 protein, His-tagged | +Inquiry |
| HAPLN1-574H | Recombinant Human HAPLN1 protein | +Inquiry |
| HAPLN1-1819M | Recombinant Mouse HAPLN1 Protein (10-356 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAPLN1-2942HCL | Recombinant Human HAPLN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN1 Products
Required fields are marked with *
My Review for All HAPLN1 Products
Required fields are marked with *



