Recombinant Mouse HAPLN1 Protein (10-356 aa), His-tagged
| Cat.No. : | HAPLN1-1819M |
| Product Overview : | Recombinant Mouse HAPLN1 Protein (10-356 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 10-356 aa |
| Description : | Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the Extracellular domain cartilage matrix. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 41.4 kDa |
| AA Sequence : | ISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | Hapln1 hyaluronan and proteoglycan link protein 1 [ Mus musculus ] |
| Official Symbol | HAPLN1 |
| Synonyms | HAPLN1; link protein; LP; CLP; LP-1; Crtl1; Crtl1l; BB099155; |
| Gene ID | 12950 |
| mRNA Refseq | NM_013500 |
| Protein Refseq | NP_038528 |
| UniProt ID | Q9QUP5 |
| ◆ Recombinant Proteins | ||
| HAPLN1-750H | Recombinant Human HAPLN1 protein, His-tagged | +Inquiry |
| HAPLN1-7478M | Recombinant Mouse HAPLN1 Protein | +Inquiry |
| HAPLN1-6744H | Recombinant Human HAPLN1 protein, His-tagged | +Inquiry |
| HAPLN1-7544H | Recombinant Human HAPLN1 protein, His-SUMO-tagged | +Inquiry |
| HAPLN1-1819M | Recombinant Mouse HAPLN1 Protein (10-356 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAPLN1-2942HCL | Recombinant Human HAPLN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN1 Products
Required fields are marked with *
My Review for All HAPLN1 Products
Required fields are marked with *
