Recombinant Mouse HAPLN1 Protein (10-356 aa), His-tagged
Cat.No. : | HAPLN1-1819M |
Product Overview : | Recombinant Mouse HAPLN1 Protein (10-356 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 10-356 aa |
Description : | Stabilizes the aggregates of proteoglycan monomers with hyaluronic acid in the Extracellular domain cartilage matrix. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 41.4 kDa |
AA Sequence : | ISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Hapln1 hyaluronan and proteoglycan link protein 1 [ Mus musculus ] |
Official Symbol | HAPLN1 |
Synonyms | HAPLN1; link protein; LP; CLP; LP-1; Crtl1; Crtl1l; BB099155; |
Gene ID | 12950 |
mRNA Refseq | NM_013500 |
Protein Refseq | NP_038528 |
UniProt ID | Q9QUP5 |
◆ Recombinant Proteins | ||
HAPLN1-4055M | Recombinant Mouse HAPLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAPLN1-7478M | Recombinant Mouse HAPLN1 Protein | +Inquiry |
HAPLN1-253H | Recombinant Human HAPLN1, His-tagged | +Inquiry |
HAPLN1-4574H | Recombinant Human HAPLN1 Protein, GST-tagged | +Inquiry |
HAPLN1-574H | Recombinant Human HAPLN1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAPLN1-2942HCL | Recombinant Human HAPLN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN1 Products
Required fields are marked with *
My Review for All HAPLN1 Products
Required fields are marked with *