Recombinant Human HAPLN1 protein, His-SUMO-tagged
| Cat.No. : | HAPLN1-7544H |
| Product Overview : | Recombinant Human HAPLN1 protein(P10915)(16-354aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 16-354aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.4 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN |
| Gene Name | HAPLN1 hyaluronan and proteoglycan link protein 1 [ Homo sapiens ] |
| Official Symbol | HAPLN1 |
| Synonyms | HAPLN1; hyaluronan and proteoglycan link protein 1; cartilage linking protein 1 , CRTL1; Cartilage link protein; cartilage-link protein; proteoglycan link protein; cartilage linking protein 1; cartilage-linking protein 1; CRTL1; |
| Gene ID | 1404 |
| mRNA Refseq | NM_001884 |
| Protein Refseq | NP_001875 |
| MIM | 115435 |
| UniProt ID | P10915 |
| ◆ Recombinant Proteins | ||
| HAPLN1-4055M | Recombinant Mouse HAPLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HAPLN1-4574H | Recombinant Human HAPLN1 Protein, GST-tagged | +Inquiry |
| HAPLN1-7031C | Recombinant Chicken HAPLN1 | +Inquiry |
| HAPLN1-750H | Recombinant Human HAPLN1 protein, His-tagged | +Inquiry |
| HAPLN1-7544H | Recombinant Human HAPLN1 protein, His-SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAPLN1-2942HCL | Recombinant Human HAPLN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN1 Products
Required fields are marked with *
My Review for All HAPLN1 Products
Required fields are marked with *
