Recombinant Full Length Human HARBI1 Protein, GST-tagged

• Cat.No.: HARBI1-3409HF
• Product Overview: Human HARBI1 full-length ORF (BAB71391.1, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 349 amino acids
• Description: HARBI1 (Harbinger Transposase Derived 1) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity, acting on ester bonds and nuclease activity.
• Molecular Mass: 65.5 kDa
• AA Sequence: MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HARBI1 harbinger transposase derived 1 [ Homo sapiens ]
• Official Symbol: HARBI1
• Synonyms: HARBI1; harbinger transposase derived 1; C11orf77, chromosome 11 open reading frame 77; putative nuclease HARBI1; FLJ32675; harbinger transposase-derived nuclease; C11orf77
• Gene ID: 283254
• mRNA Refseq: NM_173811
• Protein Refseq: NP_776172
• MIM: 615086
• UniProt ID: Q96MB7