Recombinant Full Length Human HARBI1 Protein, GST-tagged

Cat.No. : HARBI1-3409HF
Product Overview : Human HARBI1 full-length ORF (BAB71391.1, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 349 amino acids
Description : HARBI1 (Harbinger Transposase Derived 1) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity, acting on ester bonds and nuclease activity.
Molecular Mass : 65.5 kDa
AA Sequence : MAIPITVLDCDLLLYGRGHRTLDRFKLDDVTDEYLMSMYGFPRQFIYYLVELLGANLSRPTQRSRAISPETQVLAALGFYTSGSFQTRMGDAIGISQASMSRCVANVTEALVERASQFIRFPADEASIQALKDEFYGLAGMPGVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETNWPGSLQDCAVLQQSSLSSQFEAGMHKDSWLLGDSSFFLRTWLMTPLHIPETPAEYRYNMAHSATHSVIEKTFRTLCSRFRCLDGSKGALQYSPEKSSHIILACCVLHNISLEHGMDVWSSPMTGPMEQPPEEEYEHMESLDLEADRIRQELMLTHFS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HARBI1 harbinger transposase derived 1 [ Homo sapiens ]
Official Symbol HARBI1
Synonyms HARBI1; harbinger transposase derived 1; C11orf77, chromosome 11 open reading frame 77; putative nuclease HARBI1; FLJ32675; harbinger transposase-derived nuclease; C11orf77;
Gene ID 283254
mRNA Refseq NM_173811
Protein Refseq NP_776172
MIM 615086
UniProt ID Q96MB7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HARBI1 Products

Required fields are marked with *

My Review for All HARBI1 Products

Required fields are marked with *

0
cart-icon
0
compare icon