Recombinant Full Length Human HBB Protein, C-Flag-tagged
Cat.No. : | HBB-181HFL |
Product Overview : | Recombinant Full Length Human HBB Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 15.8 kDa |
AA Sequence : | MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLG AFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAN ALAHKYHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | HBB hemoglobin subunit beta [ Homo sapiens (human) ] |
Official Symbol | HBB |
Synonyms | ECYT6; CD113t-C; beta-globin |
Gene ID | 3043 |
mRNA Refseq | NM_000518.5 |
Protein Refseq | NP_000509.1 |
MIM | 141900 |
UniProt ID | P68871 |
◆ Recombinant Proteins | ||
HBB-01H | Recombinant Human HBB Protein, Myc/DDK-tagged | +Inquiry |
HBB-331C | Recombinant Cynomolgus Monkey HBB Protein, His (Fc)-Avi-tagged | +Inquiry |
HBB-181HFL | Recombinant Full Length Human HBB Protein, C-Flag-tagged | +Inquiry |
HBB-7867S | Recombinant Sheep HBB protein, His-tagged | +Inquiry |
HBB-3491HF | Recombinant Full Length Human HBB Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
HBb-49S | Native Sheep Hemoglobin Beta (HBb) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBB-5622HCL | Recombinant Human HBB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBB Products
Required fields are marked with *
My Review for All HBB Products
Required fields are marked with *