Recombinant Full Length Human HCRTR1 Protein, GST-tagged

Cat.No. : HCRTR1-3608HF
Product Overview : Human HCRTR1 full-length ORF ( AAH74796.1, 1 a.a. - 425 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 425 amino acids
Description : The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B. [provided by RefSeq
Molecular Mass : 73.9 kDa
AA Sequence : MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HCRTR1 hypocretin (orexin) receptor 1 [ Homo sapiens ]
Official Symbol HCRTR1
Synonyms HCRTR1; hypocretin (orexin) receptor 1; orexin receptor type 1; OX1R; ox1-R; ox-1-R; orexin receptor 1; orexin receptor-1; hypocretin receptor 1; hypocretin receptor-1; hypocretin receptor type 1;
Gene ID 3061
mRNA Refseq NM_001525
Protein Refseq NP_001516
MIM 602392
UniProt ID O43613

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HCRTR1 Products

Required fields are marked with *

My Review for All HCRTR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon