Recombinant Human HCRTR1 Protein (1-46 aa), His-Myc-tagged

• Cat.No.: HCRTR1-2463H
• Product Overview: Recombinant Human HCRTR1 Protein (1-46 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Metabolism. Protein Description: Partial.

Specification

• Description: Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca2+ levels in response to orexin-A binding.
• Source: E. coli
• Species: Human
• Tag: His-Myc
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 10.4 kDa
• Protein length: 1-46 aa
• AA Sequence: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: HCRTR1 hypocretin (orexin) receptor 1 [ Homo sapiens ]
• Official Symbol: HCRTR1
• Synonyms: HCRTR1; orexin receptor type 1; OX1R; ox1-R; ox-1-R; orexin receptor 1; orexin receptor-1
• Gene ID: 3061
• mRNA Refseq: NM_001525
• Protein Refseq: NP_001516
• MIM: 602392
• UniProt ID: O43613