Recombinant Human HCRTR1 Protein (1-46 aa), His-Myc-tagged

Cat.No. : HCRTR1-2463H
Product Overview : Recombinant Human HCRTR1 Protein (1-46 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Metabolism. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 1-46 aa
Description : Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca2+ levels in response to orexin-A binding.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 10.4 kDa
AA Sequence : MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name HCRTR1 hypocretin (orexin) receptor 1 [ Homo sapiens ]
Official Symbol HCRTR1
Synonyms HCRTR1; orexin receptor type 1; OX1R; ox1-R; ox-1-R; orexin receptor 1; orexin receptor-1;
Gene ID 3061
mRNA Refseq NM_001525
Protein Refseq NP_001516
MIM 602392
UniProt ID O43613

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HCRTR1 Products

Required fields are marked with *

My Review for All HCRTR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon