Recombinant Human HCRTR1 Protein (1-46 aa), His-Myc-tagged
Cat.No. : | HCRTR1-2463H |
Product Overview : | Recombinant Human HCRTR1 Protein (1-46 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-46 aa |
Description : | Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca2+ levels in response to orexin-A binding. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 10.4 kDa |
AA Sequence : | MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | HCRTR1 hypocretin (orexin) receptor 1 [ Homo sapiens ] |
Official Symbol | HCRTR1 |
Synonyms | HCRTR1; orexin receptor type 1; OX1R; ox1-R; ox-1-R; orexin receptor 1; orexin receptor-1; |
Gene ID | 3061 |
mRNA Refseq | NM_001525 |
Protein Refseq | NP_001516 |
MIM | 602392 |
UniProt ID | O43613 |
◆ Recombinant Proteins | ||
HCRTR1-5423H | Recombinant Human HCRTR1 protein, His-sumostar-tagged | +Inquiry |
HCRTR1-7523M | Recombinant Mouse HCRTR1 Protein | +Inquiry |
RFL29228RF | Recombinant Full Length Rat Orexin Receptor Type 1(Hcrtr1) Protein, His-Tagged | +Inquiry |
HCRTR1-4085M | Recombinant Mouse HCRTR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35175BF | Recombinant Full Length Bovine Orexin Receptor Type 1(Hcrtr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCRTR1-5609HCL | Recombinant Human HCRTR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCRTR1 Products
Required fields are marked with *
My Review for All HCRTR1 Products
Required fields are marked with *
0
Inquiry Basket