Recombinant Full Length Human HDAC3 Protein, GST-tagged
Cat.No. : | HDAC3-3612HF |
Product Overview : | Human HDAC3 full-length ORF ( AAH00614, 1 a.a. - 428 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 428 amino acids |
Description : | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 72.82 kDa |
AA Sequence : | MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HDAC3 histone deacetylase 3 [ Homo sapiens ] |
Official Symbol | HDAC3 |
Synonyms | HDAC3; histone deacetylase 3; HD3; RPD3; RPD3 2; SMAP45; RPD3-2; |
Gene ID | 8841 |
mRNA Refseq | NM_003883 |
Protein Refseq | NP_003874 |
MIM | 605166 |
UniProt ID | O15379 |
◆ Recombinant Proteins | ||
HDAC3-3612HF | Recombinant Full Length Human HDAC3 Protein, GST-tagged | +Inquiry |
HDAC3-56H | Recombinant Human HDAC3 protein, His-tagged | +Inquiry |
HDAC3-390H | Recombinant Human HDAC3, His-tagged | +Inquiry |
HDAC3-11224Z | Recombinant Zebrafish HDAC3 | +Inquiry |
Hdac3-1103M | Recombinant Mouse Hdac3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC3-572HCL | Recombinant Human HDAC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HDAC3 Products
Required fields are marked with *
My Review for All HDAC3 Products
Required fields are marked with *
0
Inquiry Basket