Recombinant Full Length Human HELT Protein, GST-tagged
Cat.No. : | HELT-3473HF |
Product Overview : | Human HELT full-length ORF ( AAI60136.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 327 amino acids |
Description : | HELT (Helt BHLH Transcription Factor) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and protein dimerization activity. An important paralog of this gene is HEY1. |
Molecular Mass : | 36 kDa |
AA Sequence : | MSDKLKERKVSRLSPNGTCALVVEASDSPTRHLGGPMAGKCPHGTLSVEESRVRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQGEPQEALAQIRSRVRSLVLSSATVPDQQALGRCEGPFLLLQSSGKLEKAEILEMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HELT helt bHLH transcription factor [ Homo sapiens ] |
Official Symbol | HELT |
Synonyms | HELT; helt bHLH transcription factor; HES/HEY like transcription factor , Hey like transcription factor (zebrafish); hairy and enhancer of split-related protein HELT; bHLHb44; HCM1228; HES like; HESL; MEGANE; megane bHLH factor; Mgn; Heslike; Megane bHLH factor; Hey-like transcription factor; HES/HEY-like transcription factor; Hey-like transcriptional repressor; |
Gene ID | 391723 |
mRNA Refseq | NM_001029887 |
Protein Refseq | NP_001025058 |
MIM | 617546 |
UniProt ID | A6NFD8 |
◆ Recombinant Proteins | ||
HELT-7569M | Recombinant Mouse HELT Protein | +Inquiry |
HELT-1886R | Recombinant Rhesus Macaque HELT Protein, His (Fc)-Avi-tagged | +Inquiry |
HELT-1096H | Recombinant Human HELT Protein, MYC/DDK-tagged | +Inquiry |
HELT-11797Z | Recombinant Zebrafish HELT | +Inquiry |
Helt-3381M | Recombinant Mouse Helt Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HELT Products
Required fields are marked with *
My Review for All HELT Products
Required fields are marked with *