Recombinant Full Length Human HELT Protein, GST-tagged

Cat.No. : HELT-3473HF
Product Overview : Human HELT full-length ORF ( AAI60136.1, 1 a.a. - 327 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 327 amino acids
Description : HELT (Helt BHLH Transcription Factor) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and protein dimerization activity. An important paralog of this gene is HEY1.
Molecular Mass : 36 kDa
AA Sequence : MSDKLKERKVSRLSPNGTCALVVEASDSPTRHLGGPMAGKCPHGTLSVEESRVRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQGEPQEALAQIRSRVRSLVLSSATVPDQQALGRCEGPFLLLQSSGKLEKAEILEMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HELT helt bHLH transcription factor [ Homo sapiens ]
Official Symbol HELT
Synonyms HELT; helt bHLH transcription factor; HES/HEY like transcription factor , Hey like transcription factor (zebrafish); hairy and enhancer of split-related protein HELT; bHLHb44; HCM1228; HES like; HESL; MEGANE; megane bHLH factor; Mgn; Heslike; Megane bHLH factor; Hey-like transcription factor; HES/HEY-like transcription factor; Hey-like transcriptional repressor;
Gene ID 391723
mRNA Refseq NM_001029887
Protein Refseq NP_001025058
MIM 617546
UniProt ID A6NFD8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HELT Products

Required fields are marked with *

My Review for All HELT Products

Required fields are marked with *

0
cart-icon