Recombinant Human HELT protein, His-tagged
Cat.No. : | HELT-4322H |
Product Overview : | Recombinant Human HELT protein(54-241 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 54-241 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | ILEMTVQYLRALHSADFPRGREKELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | HELT helt bHLH transcription factor [ Homo sapiens ] |
Official Symbol | HELT |
Synonyms | HELT; helt bHLH transcription factor; HES/HEY like transcription factor , Hey like transcription factor (zebrafish); hairy and enhancer of split-related protein HELT; bHLHb44; HCM1228; HES like; HESL; MEGANE; megane bHLH factor; Mgn; Heslike; Megane bHLH factor; Hey-like transcription factor; HES/HEY-like transcription factor; Hey-like transcriptional repressor; |
mRNA Refseq | NM_001029887 |
Protein Refseq | NP_001025058 |
UniProt ID | A6NFD8 |
Gene ID | 391723 |
◆ Recombinant Proteins | ||
HELT-11797Z | Recombinant Zebrafish HELT | +Inquiry |
HELT-1096H | Recombinant Human HELT Protein, MYC/DDK-tagged | +Inquiry |
Helt-3381M | Recombinant Mouse Helt Protein, Myc/DDK-tagged | +Inquiry |
HELT-7569M | Recombinant Mouse HELT Protein | +Inquiry |
HELT-4684H | Recombinant Human HELT Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HELT Products
Required fields are marked with *
My Review for All HELT Products
Required fields are marked with *