Recombinant Human HELT protein, His-tagged

• Cat.No.: HELT-4322H
• Product Overview: Recombinant Human HELT protein(54-241 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 54-241 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: ILEMTVQYLRALHSADFPRGREKELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAPVPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: HELT helt bHLH transcription factor [ Homo sapiens ]
• Official Symbol: HELT
• Synonyms: HELT; helt bHLH transcription factor; HES/HEY like transcription factor , Hey like transcription factor (zebrafish); hairy and enhancer of split-related protein HELT; bHLHb44; HCM1228; HES like; HESL; MEGANE; megane bHLH factor; Mgn; Heslike; Megane bHLH factor; Hey-like transcription factor; HES/HEY-like transcription factor; Hey-like transcriptional repressor
• mRNA Refseq: NM_001029887
• Protein Refseq: NP_001025058
• UniProt ID: A6NFD8
• Gene ID: 391723