Recombinant Full Length Human Hematopoietic Progenitor Cell Antigen Cd34(Cd34) Protein, His-Tagged
Cat.No. : | RFL26530HF |
Product Overview : | Recombinant Full Length Human Hematopoietic progenitor cell antigen CD34(CD34) Protein (P28906) (32-385aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (32-385) |
Form : | Lyophilized powder |
AA Sequence : | SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD34 |
Synonyms | CD34; Hematopoietic progenitor cell antigen CD34; CD antigen CD34 |
UniProt ID | P28906 |
◆ Recombinant Proteins | ||
CD34-502H | Recombinant Human CD34 Protein (Ser32-Thr290), C-6×His-tagged | +Inquiry |
Cd34-7475R | Recombinant Rat Cd34 protein(Met1-Thr291), hFc-tagged | +Inquiry |
CD34-228H | Recombinant Human CD34 | +Inquiry |
CD34-01H | Active Recombinant Human CD34 protein, His-tagged | +Inquiry |
CD34-152H | Recombinant Human CD34 Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD34-2232MCL | Recombinant Mouse CD34 cell lysate | +Inquiry |
CD34-3047HCL | Recombinant Human CD34 cell lysate | +Inquiry |
CD34-1408RCL | Recombinant Rat CD34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD34 Products
Required fields are marked with *
My Review for All CD34 Products
Required fields are marked with *