Recombinant Human CD34 protein, His-tagged
| Cat.No. : | CD34-3650H |
| Product Overview : | Recombinant Human CD34 protein(312-385 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 10, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 312-385 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQENGTGQATSRNGHSARQHVVADTEL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CD34 CD34 molecule [ Homo sapiens ] |
| Official Symbol | CD34 |
| Synonyms | CD34; CD34 molecule; CD34 antigen; hematopoietic progenitor cell antigen CD34; |
| Gene ID | 947 |
| mRNA Refseq | NM_001025109 |
| Protein Refseq | NP_001020280 |
| MIM | 142230 |
| UniProt ID | P28906 |
| ◆ Recombinant Proteins | ||
| CD34-228H | Recombinant Human CD34 | +Inquiry |
| CD34-1367H | Recombinant Human CD34 protein(Met 1-Thr 290), hFc-tagged, Biotinylated | +Inquiry |
| CD34-7520H | Recombinant Human CD34, His-tagged | +Inquiry |
| Cd34-2019M | Recombinant Mouse Cd34 protein, His & GST-tagged | +Inquiry |
| CD34-3099H | Recombinant Human CD34 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD34-1408RCL | Recombinant Rat CD34 cell lysate | +Inquiry |
| CD34-2232MCL | Recombinant Mouse CD34 cell lysate | +Inquiry |
| CD34-3047HCL | Recombinant Human CD34 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD34 Products
Required fields are marked with *
My Review for All CD34 Products
Required fields are marked with *
