Recombinant Full Length Human HES3 Protein, GST-tagged
Cat.No. : | HES3-3517HF |
Product Overview : | Human HES3 full-length ORF ( AAI56116.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 186 amino acids |
Description : | HES3 (Hes Family BHLH Transcription Factor 3) is a Protein Coding gene. GO annotations related to this gene include transcription factor binding and protein dimerization activity. |
Molecular Mass : | 20.5 kDa |
AA Sequence : | MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVPRGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HES3 hes family bHLH transcription factor 3 [ Homo sapiens (human) ] |
Official Symbol | HES3 |
Synonyms | HES3; hes family bHLH transcription factor 3; bHLHb43; transcription factor HES-3; class B basic helix-loop-helix protein 43; hairy and enhancer of split 3 |
Gene ID | 390992 |
mRNA Refseq | NM_001024598 |
Protein Refseq | NP_001019769 |
MIM | 609971 |
UniProt ID | Q5TGS1 |
◆ Recombinant Proteins | ||
HES3-4133M | Recombinant Mouse HES3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HES3-2831R | Recombinant Rat HES3 Protein | +Inquiry |
HES3-3108H | Recombinant Human HES3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HES3-961H | Recombinant Human HES3 | +Inquiry |
HES3-2486R | Recombinant Rat HES3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HES3 Products
Required fields are marked with *
My Review for All HES3 Products
Required fields are marked with *