Recombinant Full Length Human HES3 Protein, GST-tagged

Cat.No. : HES3-3517HF
Product Overview : Human HES3 full-length ORF ( AAI56116.1, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 186 amino acids
Description : HES3 (Hes Family BHLH Transcription Factor 3) is a Protein Coding gene. GO annotations related to this gene include transcription factor binding and protein dimerization activity.
Molecular Mass : 20.5 kDa
AA Sequence : MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVPRGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGSPGDDLN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HES3 hes family bHLH transcription factor 3 [ Homo sapiens (human) ]
Official Symbol HES3
Synonyms HES3; hes family bHLH transcription factor 3; bHLHb43; transcription factor HES-3; class B basic helix-loop-helix protein 43; hairy and enhancer of split 3
Gene ID 390992
mRNA Refseq NM_001024598
Protein Refseq NP_001019769
MIM 609971
UniProt ID Q5TGS1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HES3 Products

Required fields are marked with *

My Review for All HES3 Products

Required fields are marked with *

0
cart-icon
0
compare icon