Recombinant Full Length Human HGD Protein, C-Flag-tagged
Cat.No. : | HGD-1475HFL |
Product Overview : | Recombinant Full Length Human HGD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the enzyme homogentisate 1,2 dioxygenase. This enzyme is involved in the catabolism of the amino acids tyrosine and phenylalanine. Mutations in this gene are the cause of the autosomal recessive metabolism disorder alkaptonuria. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.8 kDa |
AA Sequence : | MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSH KPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNT SMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFEL PDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLK NFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHY EAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLD ENYHKCWEPLKSHFTPNSRNPAEPNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Tyrosine metabolism |
Full Length : | Full L. |
Gene Name | HGD homogentisate 1,2-dioxygenase [ Homo sapiens (human) ] |
Official Symbol | HGD |
Synonyms | AKU; HGO |
Gene ID | 3081 |
mRNA Refseq | NM_000187.4 |
Protein Refseq | NP_000178.2 |
MIM | 607474 |
UniProt ID | Q93099 |
◆ Recombinant Proteins | ||
HGD-1066H | Recombinant Human HGD Protein, His (Fc)-Avi-tagged | +Inquiry |
Hgd-1121M | Recombinant Mouse Hgd Protein, MYC/DDK-tagged | +Inquiry |
HGD-1475HFL | Recombinant Full Length Human HGD Protein, C-Flag-tagged | +Inquiry |
HGD-3569H | Recombinant Human HGD protein, His-tagged | +Inquiry |
HGD-4723H | Recombinant Human HGD Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HGD-5571HCL | Recombinant Human HGD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HGD Products
Required fields are marked with *
My Review for All HGD Products
Required fields are marked with *
0
Inquiry Basket