Recombinant Full Length Human HIF1AN Protein, GST-tagged

Cat.No. : HIF1AN-3467HF
Product Overview : Human HIF1AN full-length ORF ( AAH07719.1, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 349 amino acids
Description : HIF1AN (Hypoxia Inducible Factor 1 Alpha Subunit Inhibitor) is a Protein Coding gene. Diseases associated with HIF1AN include Hypoxia and Anemia Of Prematurity. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Photodynamic therapy-induced HIF-1 survival signaling. GO annotations related to this gene include protein homodimerization activity and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors. An important paralog of this gene is HSPBAP1.
Molecular Mass : 64.13 kDa
AA Sequence : MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIF1AN hypoxia inducible factor 1, alpha subunit inhibitor [ Homo sapiens ]
Official Symbol HIF1AN
Synonyms HIF1AN; hypoxia inducible factor 1, alpha subunit inhibitor; hypoxia-inducible factor 1-alpha inhibitor; DKFZp762F1811; FIH1; FLJ20615; FLJ22027; Peptide aspartate beta dioxygenase; FIH-1; factor inhibiting HIF1; factor inhibiting HIF-1; peptide-aspartate beta-dioxygenase; hypoxia-inducible factor asparagine hydroxylase;
Gene ID 55662
mRNA Refseq NM_017902
Protein Refseq NP_060372
MIM 606615
UniProt ID Q9NWT6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIF1AN Products

Required fields are marked with *

My Review for All HIF1AN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon