Recombinant Full Length Human HIF1AN Protein, GST-tagged
Cat.No. : | HIF1AN-3467HF |
Product Overview : | Human HIF1AN full-length ORF ( AAH07719.1, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 349 amino acids |
Description : | HIF1AN (Hypoxia Inducible Factor 1 Alpha Subunit Inhibitor) is a Protein Coding gene. Diseases associated with HIF1AN include Hypoxia and Anemia Of Prematurity. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Photodynamic therapy-induced HIF-1 survival signaling. GO annotations related to this gene include protein homodimerization activity and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors. An important paralog of this gene is HSPBAP1. |
Molecular Mass : | 64.13 kDa |
AA Sequence : | MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIF1AN hypoxia inducible factor 1, alpha subunit inhibitor [ Homo sapiens ] |
Official Symbol | HIF1AN |
Synonyms | HIF1AN; hypoxia inducible factor 1, alpha subunit inhibitor; hypoxia-inducible factor 1-alpha inhibitor; DKFZp762F1811; FIH1; FLJ20615; FLJ22027; Peptide aspartate beta dioxygenase; FIH-1; factor inhibiting HIF1; factor inhibiting HIF-1; peptide-aspartate beta-dioxygenase; hypoxia-inducible factor asparagine hydroxylase; |
Gene ID | 55662 |
mRNA Refseq | NM_017902 |
Protein Refseq | NP_060372 |
MIM | 606615 |
UniProt ID | Q9NWT6 |
◆ Recombinant Proteins | ||
HIF1AN-3038H | Recombinant Human HIF1AN protein, His-tagged | +Inquiry |
HIF1AN-30176H | Recombinant Human HIF1AN protein, GST-tagged | +Inquiry |
HIF1AN-7623M | Recombinant Mouse HIF1AN Protein | +Inquiry |
HIF1AN-448H | Recombinant Human HIF1AN Protein, His-tagged | +Inquiry |
HIF1AN-3353H | Recombinant Human HIF1AN protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIF1AN-5564HCL | Recombinant Human HIF1AN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIF1AN Products
Required fields are marked with *
My Review for All HIF1AN Products
Required fields are marked with *
0
Inquiry Basket