Recombinant Full Length Human HINT1 Protein, C-Flag-tagged
Cat.No. : | HINT1-1206HFL |
Product Overview : | Recombinant Full Length Human HINT1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 13.6 kDa |
AA Sequence : | MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | HINT1 histidine triad nucleotide binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | HINT1 |
Synonyms | HINT; NMAN; PKCI-1; PRKCNH1 |
Gene ID | 3094 |
mRNA Refseq | NM_005340.7 |
Protein Refseq | NP_005331.1 |
MIM | 601314 |
UniProt ID | P49773 |
◆ Recombinant Proteins | ||
HINT1-2081R | Recombinant Rhesus monkey HINT1 Protein, His-tagged | +Inquiry |
HINT1-1238R | Recombinant Rabbit HINT1 Protein, His/MYC-tagged | +Inquiry |
HINT1-238H | Recombinant Human HINT1 Protein, MYC/DDK-tagged | +Inquiry |
HINT1-1206HFL | Recombinant Full Length Human HINT1 Protein, C-Flag-tagged | +Inquiry |
HINT1-13779H | Recombinant Human HINT1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HINT1-5558HCL | Recombinant Human HINT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HINT1 Products
Required fields are marked with *
My Review for All HINT1 Products
Required fields are marked with *
0
Inquiry Basket