Recombinant Human HINT1 protein, His-tagged
| Cat.No. : | HINT1-29319TH |
| Product Overview : | Recombinant Human HINT1 protein(1-126 aa), fused with His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-126 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | HINT1 histidine triad nucleotide binding protein 1 [ Homo sapiens ] |
| Official Symbol | HINT1 |
| Synonyms | HINT1; histidine triad nucleotide binding protein 1; HINT, histidine triad nucleotide binding protein , PRKCNH1; histidine triad nucleotide-binding protein 1; PKCI 1; protein kinase C inhibitor 1; adenosine 5-monophosphoramidase; protein kinase C-interacting protein 1; HINT; PKCI-1; PRKCNH1; FLJ30414; FLJ32340; |
| Gene ID | 3094 |
| mRNA Refseq | NM_005340 |
| Protein Refseq | NP_005331 |
| MIM | 601314 |
| UniProt ID | P49773 |
| ◆ Recombinant Proteins | ||
| HINT1-1902R | Recombinant Rhesus Macaque HINT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Hint1-1126M | Recombinant Mouse Hint1 Protein, MYC/DDK-tagged | +Inquiry |
| HINT1-29319TH | Recombinant Human HINT1 protein, His-tagged | +Inquiry |
| HINT1-6255C | Recombinant Chicken HINT1 | +Inquiry |
| HINT1-0473H | Recombinant Human HINT1 Protein (M1-G126), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HINT1-5558HCL | Recombinant Human HINT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HINT1 Products
Required fields are marked with *
My Review for All HINT1 Products
Required fields are marked with *
