Recombinant Full Length Human HINT3 Protein, GST-tagged
Cat.No. : | HINT3-3471HF |
Product Overview : | Human HINT3 full-length ORF ( NP_612638.2, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 182 amino acids |
Description : | Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM |
Molecular Mass : | 46.8 kDa |
AA Sequence : | MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HINT3 histidine triad nucleotide binding protein 3 [ Homo sapiens ] |
Official Symbol | HINT3 |
Synonyms | HINT4 |
Gene ID | 135114 |
mRNA Refseq | NM_138571 |
Protein Refseq | NP_612638 |
MIM | 609998 |
UniProt ID | Q9NQE9 |
◆ Recombinant Proteins | ||
HINT3-4754H | Recombinant Human HINT3 Protein, GST-tagged | +Inquiry |
HINT3-235H | Recombinant Human HINT3 Protein, MYC/DDK-tagged | +Inquiry |
HINT3-7633M | Recombinant Mouse HINT3 Protein | +Inquiry |
HINT3-1904R | Recombinant Rhesus Macaque HINT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HINT3-4165M | Recombinant Mouse HINT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HINT3-5556HCL | Recombinant Human HINT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HINT3 Products
Required fields are marked with *
My Review for All HINT3 Products
Required fields are marked with *