Recombinant Full Length Human HINT3 Protein, GST-tagged

Cat.No. : HINT3-3471HF
Product Overview : Human HINT3 full-length ORF ( NP_612638.2, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 182 amino acids
Description : Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM
Molecular Mass : 46.8 kDa
AA Sequence : MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HINT3 histidine triad nucleotide binding protein 3 [ Homo sapiens ]
Official Symbol HINT3
Synonyms HINT4
Gene ID 135114
mRNA Refseq NM_138571
Protein Refseq NP_612638
MIM 609998
UniProt ID Q9NQE9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HINT3 Products

Required fields are marked with *

My Review for All HINT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon