Recombinant Human HINT3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : HINT3-3470H
Product Overview : HINT3 MS Standard C13 and N15-labeled recombinant protein (NP_612638) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides.
Molecular Mass : 20.4 kDa
AA Sequence : MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name HINT3 histidine triad nucleotide binding protein 3 [ Homo sapiens (human) ]
Official Symbol HINT3
Synonyms HINT3; histidine triad nucleotide binding protein 3; HINT4; histidine triad nucleotide-binding protein 3; HINT-3; HIT-like protein; EC 3.-.-.-
Gene ID 135114
mRNA Refseq NM_138571
Protein Refseq NP_612638
MIM 609998
UniProt ID Q9NQE9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HINT3 Products

Required fields are marked with *

My Review for All HINT3 Products

Required fields are marked with *

0
cart-icon
0
compare icon