Recombinant Human HINT3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HINT3-3470H
• Product Overview: HINT3 MS Standard C13 and N15-labeled recombinant protein (NP_612638) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides.
• Molecular Mass: 20.4 kDa
• AA Sequence: MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HINT3 histidine triad nucleotide binding protein 3 [ Homo sapiens (human) ]
• Official Symbol: HINT3
• Synonyms: HINT3; histidine triad nucleotide binding protein 3; HINT4; histidine triad nucleotide-binding protein 3; HINT-3; HIT-like protein; EC 3.-.-.-
• Gene ID: 135114
• mRNA Refseq: NM_138571
• Protein Refseq: NP_612638
• MIM: 609998
• UniProt ID: Q9NQE9