Recombinant Human HINT3 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HINT3-3470H |
Product Overview : | HINT3 MS Standard C13 and N15-labeled recombinant protein (NP_612638) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides. |
Molecular Mass : | 20.4 kDa |
AA Sequence : | MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAGKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPFCSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKLRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HINT3 histidine triad nucleotide binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | HINT3 |
Synonyms | HINT3; histidine triad nucleotide binding protein 3; HINT4; histidine triad nucleotide-binding protein 3; HINT-3; HIT-like protein; EC 3.-.-.- |
Gene ID | 135114 |
mRNA Refseq | NM_138571 |
Protein Refseq | NP_612638 |
MIM | 609998 |
UniProt ID | Q9NQE9 |
◆ Recombinant Proteins | ||
HINT3-4165M | Recombinant Mouse HINT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HINT3-4754H | Recombinant Human HINT3 Protein, GST-tagged | +Inquiry |
HINT3-235H | Recombinant Human HINT3 Protein, MYC/DDK-tagged | +Inquiry |
HINT3-3470H | Recombinant Human HINT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HINT3-2083R | Recombinant Rhesus monkey HINT3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HINT3-5556HCL | Recombinant Human HINT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HINT3 Products
Required fields are marked with *
My Review for All HINT3 Products
Required fields are marked with *