Recombinant Full Length Human HIST1H1A Protein, GST-tagged
Cat.No. : | HIST1H1A-3564HF |
Product Overview : | Human HIST1H1A full-length ORF ( NP_005316.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 215 amino acids |
Description : | Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq |
Molecular Mass : | 48.2 kDa |
AA Sequence : | MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQAASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTKGTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSVKTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVTKPKTAKPKKAAPKKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIST1H1A histone cluster 1, H1a [ Homo sapiens ] |
Official Symbol | HIST1H1A |
Synonyms | HIST1H1A; histone cluster 1, H1a; H1 histone family, member 1 , H1F1, histone 1, H1a; histone H1.1; H1.1; H1a; histone 1, H1a; H1 histone family, member 1; H1A; H1F1; HIST1; MGC126642; MGC138345; |
Gene ID | 3024 |
mRNA Refseq | NM_005325 |
Protein Refseq | NP_005316 |
MIM | 142709 |
UniProt ID | Q02539 |
◆ Recombinant Proteins | ||
HIST1H1A-231H | Recombinant Human HIST1H1A Protein, MYC/DDK-tagged | +Inquiry |
HIST1H1A-3564HF | Recombinant Full Length Human HIST1H1A Protein, GST-tagged | +Inquiry |
HIST1H1A-1906R | Recombinant Rhesus Macaque HIST1H1A Protein, His (Fc)-Avi-tagged | +Inquiry |
HIST1H1A-2848R | Recombinant Rat HIST1H1A Protein | +Inquiry |
HIST1H1A-4773H | Recombinant Human HIST1H1A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST1H1A-5555HCL | Recombinant Human HIST1H1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIST1H1A Products
Required fields are marked with *
My Review for All HIST1H1A Products
Required fields are marked with *
0
Inquiry Basket