Recombinant Full Length Human HIST3H2BB Protein, GST-tagged

Cat.No. : HIST3H2BB-3605HF
Product Overview : Human HIST3H2BB full-length ORF (BAC03613.1, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 126 amino acids
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq
Molecular Mass : 40.3 kDa
AA Sequence : MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST3H2BB histone cluster 3 H2B family member b [ Homo sapiens (human) ]
Official Symbol HIST3H2BB
Synonyms HIST3H2BB; histone cluster 3 H2B family member b; H2Bb; histone H2B type 3-B; H2B type 12; histone 3, H2bb; histone cluster 3, H2bb
Gene ID 128312
mRNA Refseq NM_175055
Protein Refseq NP_778225
MIM 615046
UniProt ID Q8N257

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST3H2BB Products

Required fields are marked with *

My Review for All HIST3H2BB Products

Required fields are marked with *

0
cart-icon