Recombinant Full Length Human Hla Class Ii Histocompatibility Antigen, Dp Alpha 1 Chain(Hla-Dpa1) Protein, His-Tagged
Cat.No. : | RFL26724HF |
Product Overview : | Recombinant Full Length Human HLA class II histocompatibility antigen, DP alpha 1 chain(HLA-DPA1) Protein (P20036) (29-260aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (29-260) |
Form : | Lyophilized powder |
AA Sequence : | AGAIKADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HLA-DPA1 |
Synonyms | HLA-DPA1; HLA-DP1A; HLASBHLA class II histocompatibility antigen; DP alpha 1 chain; DP(W3); DP(W4); HLA-SB alpha chain; MHC class II DP3-alpha; MHC class II DPA1 |
UniProt ID | P20036 |
◆ Recombinant Proteins | ||
HLA-DPA1-3427H | Recombinant Human HLA-DPA1 protein, His-tagged | +Inquiry |
HLA-DPA1-3582HF | Recombinant Full Length Human HLA-DPA1 Protein, GST-tagged | +Inquiry |
HLA-DPA1-4840H | Recombinant Human HLA-DPA1 Protein, GST-tagged | +Inquiry |
RFL26724HF | Recombinant Full Length Human Hla Class Ii Histocompatibility Antigen, Dp Alpha 1 Chain(Hla-Dpa1) Protein, His-Tagged | +Inquiry |
HLA-DPA1-5290H | Recombinant Human HLA-DPA1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DPA1-5506HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-DPA1 Products
Required fields are marked with *
My Review for All HLA-DPA1 Products
Required fields are marked with *
0
Inquiry Basket