Recombinant Full Length Human HM13 Protein, GST-tagged

Cat.No. : HM13-3635HF
Product Overview : Human HM13 full-length ORF ( NP_848697.1, 1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 143 amino acids
Description : The protein encoded by this gene, which localizes to the endoplasmic reticulum, catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein. This activity is required to generate signal sequence-derived human lymphocyte antigen-E epitopes that are recognized by the immune system, and to process hepatitis C virus core protein. The encoded protein is an integral membrane protein with sequence motifs characteristic of the presenilin-type aspartic proteases. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 41.80 kDa
AA Sequence : MDSALSDPHNGSAEAGGPTNSTTRPPSTPEGIALAYGSLLLMALLPIFFGALRSVRCARGKNASDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLLLSMYFFVLGILALSHTIRSEGISLQHLKQLSREPVQGLG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HM13 histocompatibility (minor) 13 [ Homo sapiens ]
Official Symbol HM13
Synonyms HM13; histocompatibility (minor) 13; minor histocompatibility antigen H13; dJ324O17.1; H13; IMP1; IMPAS; intramembrane protease; presenilin like protein 3; PSENL3; PSL3; signal peptide peptidase beta; signal peptide peptidase like 1; SPP; SPPL1; IMP-1; hIMP1; intramembrane protease 1; presenilin-like protein 3; minor histocompatibility antigen 13; IMPAS-1; MSTP086;
Gene ID 81502
mRNA Refseq NM_030789
Protein Refseq NP_110416
MIM 607106
UniProt ID Q8TCT9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HM13 Products

Required fields are marked with *

My Review for All HM13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon