Recombinant Human HM13 protein, His-tagged
Cat.No. : | HM13-21H |
Product Overview : | Recombinant Human HM13 protein(NP_110416)(111-220 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 111-220 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | VLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HM13 histocompatibility (minor) 13 [ Homo sapiens ] |
Official Symbol | HM13 |
Synonyms | HM13; histocompatibility (minor) 13; minor histocompatibility antigen H13; dJ324O17.1; H13; IMP1; IMPAS; intramembrane protease; presenilin like protein 3; PSENL3; PSL3; signal peptide peptidase beta; signal peptide peptidase like 1; SPP; SPPL1; IMP-1; hIMP1; intramembrane protease 1; presenilin-like protein 3; minor histocompatibility antigen 13; IMPAS-1; MSTP086; |
Gene ID | 81502 |
mRNA Refseq | NM_030789 |
Protein Refseq | NP_110416 |
MIM | 607106 |
UniProt ID | Q8TCT9 |
◆ Recombinant Proteins | ||
HM13-3635HF | Recombinant Full Length Human HM13 Protein, GST-tagged | +Inquiry |
HM13-2104R | Recombinant Rhesus monkey HM13 Protein, His-tagged | +Inquiry |
HM13-4855H | Recombinant Human HM13 Protein, GST-tagged | +Inquiry |
HM13-11852Z | Recombinant Zebrafish HM13 | +Inquiry |
HM13-1925R | Recombinant Rhesus Macaque HM13 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HM13-5487HCL | Recombinant Human HM13 293 Cell Lysate | +Inquiry |
HM13-5486HCL | Recombinant Human HM13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HM13 Products
Required fields are marked with *
My Review for All HM13 Products
Required fields are marked with *