Recombinant Human HM13 protein, His-tagged

Cat.No. : HM13-21H
Product Overview : Recombinant Human HM13 protein(NP_110416)(111-220 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 111-220 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : VLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDV
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name HM13 histocompatibility (minor) 13 [ Homo sapiens ]
Official Symbol HM13
Synonyms HM13; histocompatibility (minor) 13; minor histocompatibility antigen H13; dJ324O17.1; H13; IMP1; IMPAS; intramembrane protease; presenilin like protein 3; PSENL3; PSL3; signal peptide peptidase beta; signal peptide peptidase like 1; SPP; SPPL1; IMP-1; hIMP1; intramembrane protease 1; presenilin-like protein 3; minor histocompatibility antigen 13; IMPAS-1; MSTP086;
Gene ID 81502
mRNA Refseq NM_030789
Protein Refseq NP_110416
MIM 607106
UniProt ID Q8TCT9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HM13 Products

Required fields are marked with *

My Review for All HM13 Products

Required fields are marked with *

0
cart-icon
0
compare icon