Recombinant Human HM13 protein, His-tagged

• Cat.No.: HM13-21H
• Product Overview: Recombinant Human HM13 protein(NP_110416)(111-220 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 111-220 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: VLGILALSHTISPFMNKFFPASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDV
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
• Concentration: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: HM13 histocompatibility (minor) 13 [ Homo sapiens ]
• Official Symbol: HM13
• Synonyms: HM13; histocompatibility (minor) 13; minor histocompatibility antigen H13; dJ324O17.1; H13; IMP1; IMPAS; intramembrane protease; presenilin like protein 3; PSENL3; PSL3; signal peptide peptidase beta; signal peptide peptidase like 1; SPP; SPPL1; IMP-1; hIMP1; intramembrane protease 1; presenilin-like protein 3; minor histocompatibility antigen 13; IMPAS-1; MSTP086
• Gene ID: 81502
• mRNA Refseq: NM_030789
• Protein Refseq: NP_110416
• MIM: 607106
• UniProt ID: Q8TCT9