Recombinant Full Length Human HMGN1 Protein, GST-tagged
Cat.No. : | HMGN1-3658HF |
Product Overview : | Human HMGN1 full-length ORF ( AAH23984, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 100 amino acids |
Description : | Chromosomal protein HMG14 and its close analog HMG17 (MIM 163910) bind to the inner side of the nucleosomal DNA, potentially altering the interaction between the DNA and the histone octamer. The 2 proteins may be involved in the process that maintains transcribable genes in a unique chromatin conformation. Their ubiquitous distribution and relative abundance, as well as the high evolutionary conservation of the DNA-binding domain of the HMG14 family of proteins, suggest that they may be involved in an important cellular function.[supplied by OMIM |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HMGN1 high mobility group nucleosome binding domain 1 [ Homo sapiens ] |
Official Symbol | HMGN1 |
Synonyms | HMGN1; high mobility group nucleosome binding domain 1; high mobility group (nonhistone chromosomal) protein 14 , high mobility group nucleosome binding domain 1 , HMG14; non-histone chromosomal protein HMG-14; FLJ27265; FLJ31471; high mobility group nucleosome binding 1; MGC104230; MGC117425; nonhistone chromosomal protein HMG 14; nonhistone chromosomal protein HMG-14; high-mobility group nucleosome binding 1; high-mobility group nucleosome binding domain 1; high-mobility group (nonhistone chromosomal) protein 14; high mobility group nucleosome-binding domain-containing protein 1; HMG14; |
Gene ID | 3150 |
mRNA Refseq | NM_004965 |
Protein Refseq | NP_004956 |
MIM | 163920 |
UniProt ID | P05114 |
◆ Recombinant Proteins | ||
HMGN1-2050H | Recombinant Human HMGN1, His-tagged | +Inquiry |
HMGN1-7736M | Recombinant Mouse HMGN1 Protein | +Inquiry |
HMGN1-13849H | Recombinant Human HMGN1, GST-tagged | +Inquiry |
HMGN1-4243M | Recombinant Mouse HMGN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGN1-6663C | Recombinant Chicken HMGN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMGN1-5473HCL | Recombinant Human HMGN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGN1 Products
Required fields are marked with *
My Review for All HMGN1 Products
Required fields are marked with *