Recombinant Full Length Human HMOX1 Protein, C-Flag-tagged
Cat.No. : | HMOX1-1170HFL |
Product Overview : | Recombinant Full Length Human HMOX1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.6 kDa |
AA Sequence : | MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKE SPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQHYVKRLHEVGRTEPELLVAHAYTRYLGD LSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN IQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVAT VAVGLYAMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Porphyrin and chlorophyll metabolism |
Full Length : | Full L. |
Gene Name | HMOX1 heme oxygenase 1 [ Homo sapiens (human) ] |
Official Symbol | HMOX1 |
Synonyms | HO-1; HSP32; HMOX1D; bK286B10 |
Gene ID | 3162 |
mRNA Refseq | NM_002133.3 |
Protein Refseq | NP_002124.1 |
MIM | 141250 |
UniProt ID | P09601 |
◆ Recombinant Proteins | ||
HMOX1-1556H | Recombinant Human HMOX1 protein, His-tagged | +Inquiry |
HMOX1-1703H | Recombinant Human Heme Oxygenase 1, His-tagged | +Inquiry |
Hmox1-716R | Recombinant Rat Heme Oxygenase (Decycling) 1 | +Inquiry |
HMOX1-1597H | Recombinant Human Heme Oxygenase (decycling) 1, GST-tagged | +Inquiry |
HMOX1-3082H | Recombinant Human HMOX1 Protein (Met1-Thr261) | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMOX1-5467HCL | Recombinant Human HMOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMOX1 Products
Required fields are marked with *
My Review for All HMOX1 Products
Required fields are marked with *
0
Inquiry Basket