Recombinant Full Length Human HMOX1 Protein, C-Flag-tagged

Cat.No. : HMOX1-1170HFL
Product Overview : Recombinant Full Length Human HMOX1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 32.6 kDa
AA Sequence : MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKE SPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQHYVKRLHEVGRTEPELLVAHAYTRYLGD LSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLN IQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVAT
VAVGLYAMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Transmembrane
Protein Pathways : Porphyrin and chlorophyll metabolism
Full Length : Full L.
Gene Name HMOX1 heme oxygenase 1 [ Homo sapiens (human) ]
Official Symbol HMOX1
Synonyms HO-1; HSP32; HMOX1D; bK286B10
Gene ID 3162
mRNA Refseq NM_002133.3
Protein Refseq NP_002124.1
MIM 141250
UniProt ID P09601

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HMOX1 Products

Required fields are marked with *

My Review for All HMOX1 Products

Required fields are marked with *

0
cart-icon
0
compare icon