Recombinant Full Length Human HNF4A Protein, C-Flag-tagged
Cat.No. : | HNF4A-88HFL |
Product Overview : | Recombinant Full Length Human HNF4A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52.6 kDa |
AA Sequence : | MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ IDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ MIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways : | Maturity onset diabetes of the young |
Full Length : | Full L. |
Gene Name | HNF4A hepatocyte nuclear factor 4 alpha [ Homo sapiens (human) ] |
Official Symbol | HNF4A |
Synonyms | TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; TCF-14; HNF4alpha |
Gene ID | 3172 |
mRNA Refseq | NM_000457.6 |
Protein Refseq | NP_000448.3 |
MIM | 600281 |
UniProt ID | P41235 |
◆ Recombinant Proteins | ||
HNF4A-5470H | Recombinant Human HNF4A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HNF4A-7752M | Recombinant Mouse HNF4A Protein | +Inquiry |
HNF4A-28507TH | Recombinant Human HNF4A | +Inquiry |
HNF4A-4255M | Recombinant Mouse HNF4A Protein, His (Fc)-Avi-tagged | +Inquiry |
HNF4A-6877H | Recombinant Human HNF4A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNF4A-5459HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
HNF4A-5457HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
HNF4A-5456HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
HNF4A-5458HCL | Recombinant Human HNF4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNF4A Products
Required fields are marked with *
My Review for All HNF4A Products
Required fields are marked with *
0
Inquiry Basket