Recombinant Full Length Human HNRNPLL Protein, C-Flag-tagged
| Cat.No. : | HNRNPLL-1691HFL |
| Product Overview : | Recombinant Full Length Human HNRNPLL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | HNRNPLL is a master regulator of activation-induced alternative splicing in T cells. In particular, it alters splicing of CD45, a tyrosine phosphatase essential for T-cell development and activation. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 59.9 kDa |
| AA Sequence : | MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHH KVSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSAKECVTFAADEPVYIAG QQAFFNYSTSKRITRPGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGIQAMV EFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILG EHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS RVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSVVPSQIFEL EDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDA KPSAKTLSGLLEWECKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTSSHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | HNRNPLL heterogeneous nuclear ribonucleoprotein L like [ Homo sapiens (human) ] |
| Official Symbol | HNRNPLL |
| Synonyms | SRRF; HNRPLL |
| Gene ID | 92906 |
| mRNA Refseq | NM_138394.4 |
| Protein Refseq | NP_612403.2 |
| MIM | 611208 |
| UniProt ID | Q8WVV9 |
| ◆ Recombinant Proteins | ||
| HNRNPLL-1846H | Recombinant Human HNRNPLL Protein, MYC/DDK-tagged | +Inquiry |
| HNRNPLL-132H | Recombinant Human HNRNPLL Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HNRNPLL-1090H | Recombinant Human HNRNPLL Protein, His (Fc)-Avi-tagged | +Inquiry |
| Hnrnpll-3424M | Recombinant Mouse Hnrnpll Protein, Myc/DDK-tagged | +Inquiry |
| HNRNPLL-1691HFL | Recombinant Full Length Human HNRNPLL Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPLL Products
Required fields are marked with *
My Review for All HNRNPLL Products
Required fields are marked with *
