Recombinant Full Length Human HNRNPLL Protein, C-Flag-tagged
Cat.No. : | HNRNPLL-1691HFL |
Product Overview : | Recombinant Full Length Human HNRNPLL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | HNRNPLL is a master regulator of activation-induced alternative splicing in T cells. In particular, it alters splicing of CD45, a tyrosine phosphatase essential for T-cell development and activation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 59.9 kDa |
AA Sequence : | MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHH KVSVSPVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSAKECVTFAADEPVYIAG QQAFFNYSTSKRITRPGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGIQAMV EFESVLCAQKAKAALNGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILG EHPSSFRHDGYGSHGPLLPLPSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCS RVFNLFCLYGNIEKVKFMKTIPGTALVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSVVPSQIFEL EDGTSSYKDFAMSKNNRFTSAGQASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDA KPSAKTLSGLLEWECKTDAVEALTALNHYQIRVPNGSNPYTLKLCFSTSSHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | HNRNPLL heterogeneous nuclear ribonucleoprotein L like [ Homo sapiens (human) ] |
Official Symbol | HNRNPLL |
Synonyms | SRRF; HNRPLL |
Gene ID | 92906 |
mRNA Refseq | NM_138394.4 |
Protein Refseq | NP_612403.2 |
MIM | 611208 |
UniProt ID | Q8WVV9 |
◆ Recombinant Proteins | ||
HNRNPLL-1846H | Recombinant Human HNRNPLL Protein, MYC/DDK-tagged | +Inquiry |
HNRNPLL-132H | Recombinant Human HNRNPLL Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
HNRNPLL-1090H | Recombinant Human HNRNPLL Protein, His (Fc)-Avi-tagged | +Inquiry |
Hnrnpll-3424M | Recombinant Mouse Hnrnpll Protein, Myc/DDK-tagged | +Inquiry |
HNRNPLL-1691HFL | Recombinant Full Length Human HNRNPLL Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPLL Products
Required fields are marked with *
My Review for All HNRNPLL Products
Required fields are marked with *