Recombinant Full Length Human HORMAD2 Protein, GST-tagged
Cat.No. : | HORMAD2-3703HF |
Product Overview : | Human HORMAD2 full-length ORF ( NP_689723.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 307 amino acids |
Description : | HORMAD2 (HORMA Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is HORMAD1. |
Molecular Mass : | 61.7 kDa |
AA Sequence : | MATAQLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKASVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEGVNSHFLLFDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFVCSQQSSECSRKKRKVSEPVKVFIPNRK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HORMAD2 HORMA domain containing 2 [ Homo sapiens ] |
Official Symbol | HORMAD2 |
Synonyms | HORMAD2; HORMA domain containing 2; HORMA domain-containing protein 2; MGC26710; |
Gene ID | 150280 |
mRNA Refseq | NM_152510 |
Protein Refseq | NP_689723 |
MIM | 618842 |
UniProt ID | Q8N7B1 |
◆ Recombinant Proteins | ||
HORMAD2-3703HF | Recombinant Full Length Human HORMAD2 Protein, GST-tagged | +Inquiry |
HORMAD2-1507H | Recombinant Human HORMAD2 | +Inquiry |
Hormad2-3432M | Recombinant Mouse Hormad2 Protein, Myc/DDK-tagged | +Inquiry |
HORMAD2-651H | Recombinant Human HORMAD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HORMAD2-4936H | Recombinant Human HORMAD2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HORMAD2-5431HCL | Recombinant Human HORMAD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HORMAD2 Products
Required fields are marked with *
My Review for All HORMAD2 Products
Required fields are marked with *