Recombinant Full Length Human HOXD4 Protein, GST-tagged

Cat.No. : HOXD4-3736HF
Product Overview : Human HOXD4 full-length ORF ( NP_055436.2, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 255 amino acids
Description : This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5 end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined. [provided by RefSeq
Molecular Mass : 54.3 kDa
AA Sequence : MVMSSYMVNSKYVDPKFPPCEEYLQGGYLGEQGADYYGGGAQGADFQPPGLYPRPDFGEQPFGGSGPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HOXD4 homeobox D4 [ Homo sapiens ]
Official Symbol HOXD4
Synonyms HOXD4; homeobox D4; homeo box D4 , HOX4, HOX4B; homeobox protein Hox-D4; homeobox protein Hox-4B; homeobox protein HHO.C13; homeobox protein Hox-5.1; Hox-4.2, mouse, homolog of homeo box X; HOX4; HOX4B; HHO.C13; HOX-5.1; Hox-4.2;
Gene ID 3233
mRNA Refseq NM_014621
Protein Refseq NP_055436
MIM 142981
UniProt ID P09016

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HOXD4 Products

Required fields are marked with *

My Review for All HOXD4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon